PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100034100091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 247aa    MW: 26586.4 Da    PI: 8.9597
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100034100091genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof71.21.5e-2234702763
                        zf-Dof 27 sqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                                   +PryfCk+CrryWt+GG+lrnvPvGgg+rknkksss
  Ote100034100091|100034100091 34 RKPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNKKSSS 70
                                  58*******************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088415.5011267IPR003851Zinc finger, Dof-type
PfamPF027018.8E-173467IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-73558IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MDSAQWTQEF GVGKPMAEIG APNACTRPQP QVERKPRYFC KTCRRYWTEG GTLRNVPVGG  60
GSRKNKKSSS SSSSIINPPL HKLPDLNPPS ISPFPSQNPK IHDQGQDLNL GFQAGPQDYS  120
HVPQFLESNA MNSASSANSS TSTTTFSALD FFRNGIAARG LNSFLPTTLE NSTVFGSGFS  180
FQECKPALLF PIEGRNGSSS VAQENVNGSL MFTLGGARRN SSDQGGEHKG QENSNGFWNG  240
MLGGSSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083160.11e-58PREDICTED: dof zinc finger protein DOF2.5 isoform X2
RefseqXP_012843875.11e-58PREDICTED: dof zinc finger protein DOF2.5 isoform X2
TrEMBLA0A068UJL62e-64A0A068UJL6_COFCA; Uncharacterized protein
STRINGPOPTR_0014s09640.14e-53(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419